Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb) (Active)

Product Specifications

Product Name Alternative

Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS

Abbreviation

Recombinant Mouse Pdgfb protein (Active)

Gene Name

Pdgfb

UniProt

AAH53430.1

Expression Region

82-190aa

Organism

Mus musculus (Mouse)

Target Sequence

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. As growth factor, it plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. It is required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. PDGFB also plays an important role in wound healing.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/c3T3 mouse fibroblast cells is 1.55 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 4 mM HCl

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCD2 Antibody
MBS9630012-01 0.1 mL

SMARCD2 Antibody

Sign In for Pricing
View Details
SMARCD2 Antibody
MBS9630012-02 0.2 mL

SMARCD2 Antibody

Sign In for Pricing
View Details
SMARCD2 Antibody
MBS9630012-03 5x 0.2 mL

SMARCD2 Antibody

Sign In for Pricing
View Details
SIGLEC14 (NM_001098612) Human Tagged Lenti ORF Clone
RC224202L4 10 µg

SIGLEC14 (NM_001098612) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SNORA11 AAV Vector (Human) (CMV)
44567101 1 µg

SNORA11 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mouse Protein KHNYN (KHNYN) ELISA Kit
abx529910 96 Tests

Mouse Protein KHNYN (KHNYN) ELISA Kit

Sign In for Pricing
View Details