Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1)

Product Specifications

Product Name Alternative

4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I

Abbreviation

Recombinant Human EIF4EBP1 protein

Gene Name

EIF4EBP1

UniProt

Q13541

Expression Region

2-118aa

Organism

Homo sapiens (Human)

Target Sequence

SGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SOD1 Antibody
RC-5931-01 50 μL

Recombinant SOD1 Antibody

Sign In for Pricing
View Details
Recombinant SOD1 Antibody
RC-5931-02 100 µL

Recombinant SOD1 Antibody

Sign In for Pricing
View Details
Recombinant SOD1 Antibody
RC-5931-03 1 mL

Recombinant SOD1 Antibody

Sign In for Pricing
View Details
Azacyclotridec-3-en-2-one
TRC-A473955-5MG 5 mg

Azacyclotridec-3-en-2-one

Sign In for Pricing
View Details
Apex2 Mouse Gene Knockout Kit (CRISPR)
KN501393 1 Kit

Apex2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PPP1R14D (NM_017726) Human Recombinant Protein
TP311763M 100 µg

PPP1R14D (NM_017726) Human Recombinant Protein

Sign In for Pricing
View Details