Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNCG, Human

SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

SNCG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sncg-protein-human.html

Purity

98.0

Smiles

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Molecular Formula

6623 (Gene_ID) O76070 (M1-D127) (Accession)

Molecular Weight

Approximately 16-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BID (BH3 Interacting Domain Death agonist, FP497, MGC15319, MGC42355) (FITC)
MBS6177279-01 0.1 mL

BID (BH3 Interacting Domain Death agonist, FP497, MGC15319, MGC42355) (FITC)

Ask
View Details
BID (BH3 Interacting Domain Death agonist, FP497, MGC15319, MGC42355) (FITC)
MBS6177279-02 5x 0.1 mL

BID (BH3 Interacting Domain Death agonist, FP497, MGC15319, MGC42355) (FITC)

Ask
View Details
CDC25A, phosphorylated (Ser278) (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A)
C2560-01D 200 µL

CDC25A, phosphorylated (Ser278) (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A)

Ask
View Details
MUC3 (Mucin 3) BioAssayTM ELISA Kit (Human) discontinued
357469-01 48 Tests

MUC3 (Mucin 3) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
MUC3 (Mucin 3) BioAssayTM ELISA Kit (Human) discontinued
357469-02 96 Tests

MUC3 (Mucin 3) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
ZBTB16, phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (MaxLight 650) discontinued
Z0744-35-ML650 100 µL

ZBTB16, phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (MaxLight 650) discontinued

Ask
View Details