Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNCG, Human

SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

SNCG Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sncg-protein-human.html

Purity

98.0

Smiles

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Molecular Formula

6623 (Gene_ID) O76070 (M1-D127) (Accession)

Molecular Weight

Approximately 16-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-500 1x 500 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-100 1x 100 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF640R conjugate, 0.1mg/mL
BNC401628-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details