Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD5, Mouse (HEK293, His)

CD5 protein, acting as a receptor, crucially regulates T-cell proliferation by engaging in vital interactions with CD72/LYB-2. Additionally, its potential interactions with PTPN6/SHP-1 highlight its integral role in essential signaling pathways. CD5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd5-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPN

Molecular Formula

12507 (Gene_ID) P13379 (Q24-N370) (Accession)

Molecular Weight

42-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18) (C-term) Rabbit Polyclonal Antibody
AP17266PU-N 400 µL

Cytokeratin 18 (KRT18) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)
KN222962LP 1 Kit

Nectin 3 (NECTIN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF706 (NM_001042510) Human Recombinant Protein
TP316962M 100 µg

ZNF706 (NM_001042510) Human Recombinant Protein

Sign In for Pricing
View Details
GABA A Receptor alpha 1 (GABRA1) Mouse Monoclonal Antibody [Clone ID: N95/35]
75-136 100 µL

GABA A Receptor alpha 1 (GABRA1) Mouse Monoclonal Antibody [Clone ID: N95/35]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details