Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 beta/CCL19, Human

The MIP-3 beta/CCL19 protein exhibits multifaceted effects affecting lymphocyte recycling, homing, and immune responses. It is involved in T cell trafficking in the thymus and guides T cells and B cells to secondary lymphoid organs by binding to CCR7. MIP-3 beta/CCL19 Protein, Human is the recombinant human-derived MIP-3 beta/CCL19 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-3 beta/CCL19 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-beta-ccl19-protein-human.html

Purity

95.00

Smiles

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Molecular Formula

6363 (Gene_ID) Q99731 (G22-S98) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCART1 (SLC25A51) Human siRNA Oligo Duplex (Locus ID 92014)
SR314157 1 Kit

MCART1 (SLC25A51) Human siRNA Oligo Duplex (Locus ID 92014)

Sign In for Pricing
View Details
Rabbit Monoclonal p53R2 Antibody (074) [DyLight 405]
NBP2-90186V 0.1 mL

Rabbit Monoclonal p53R2 Antibody (074) [DyLight 405]

Sign In for Pricing
View Details
Ncam1 (NM_001081445) Mouse Tagged Lenti ORF Clone
MR227176L3 10 µg

Ncam1 (NM_001081445) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CPS1/Hep Par-1 (OCH1E5) Mouse Monoclonal Antibody (Clone previously known as Hepatocyte Specific Antigen)
CST 96422S 100 µL

CPS1/Hep Par-1 (OCH1E5) Mouse Monoclonal Antibody (Clone previously known as Hepatocyte Specific Antigen)

Sign In for Pricing
View Details
FAK (Phospho-Ser 722) Mouse Monoclonal Antibody
AMM86146-01 1 Each

FAK (Phospho-Ser 722) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
FAK (Phospho-Ser 722) Mouse Monoclonal Antibody
AMM86146-02 50 µL

FAK (Phospho-Ser 722) Mouse Monoclonal Antibody

Sign In for Pricing
View Details