Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276/B7-H3, Mouse (HEK293, His)

CD276/B7-H3 Protein, Mouse (HEK293, His) is induced upon T cell activation. B7-H3 selectively increases the production of IFN-γ[1].

Product Specifications

Product Name Alternative

CD276/B7-H3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h3-protein-mouse-hek293-his.html

Purity

95.0

Smiles

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFHHHHHH

Molecular Formula

102657 (Gene_ID) Q8VE98 (V29-F244) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]A I Chapoval, et al. B7-H3: a costimulatory molecule for T cell activation and IFN-gamma production. Nat Immunol. 2001 Mar;2 (3) :269-74.|[2]Mingyi Sun, et al. Characterization of Mouse and Human B7-H3 Genes1. J Immunol 2002; 168:6294-6297.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Triglycidyl isocyanurate 10g
A22423-10000 10000 mg

Triglycidyl isocyanurate 10g

Ask
View Details
Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)
MBS6212788-01 0.1 mL

Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)

Ask
View Details
Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)
MBS6212788-02 5x 0.1 mL

Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)

Ask
View Details
yebF Antibody, Biotin conjugated
A50724-50UG 50 µg

yebF Antibody, Biotin conjugated

Ask
View Details
Simian F10 (Coagulation Factor X) ELISA Kit
ELK11725-01 48 Tests

Simian F10 (Coagulation Factor X) ELISA Kit

Ask
View Details
Simian F10 (Coagulation Factor X) ELISA Kit
ELK11725-02 96 Tests

Simian F10 (Coagulation Factor X) ELISA Kit

Ask
View Details