Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276/B7-H3, Mouse (HEK293, His)

CD276/B7-H3 Protein, Mouse (HEK293, His) is induced upon T cell activation. B7-H3 selectively increases the production of IFN-γ[1].

Product Specifications

Product Name Alternative

CD276/B7-H3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h3-protein-mouse-hek293-his.html

Purity

95.0

Smiles

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFHHHHHH

Molecular Formula

102657 (Gene_ID) Q8VE98 (V29-F244) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]A I Chapoval, et al. B7-H3: a costimulatory molecule for T cell activation and IFN-gamma production. Nat Immunol. 2001 Mar;2 (3) :269-74.|[2]Mingyi Sun, et al. Characterization of Mouse and Human B7-H3 Genes1. J Immunol 2002; 168:6294-6297.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TK1 antibody
FNab08718 100 µg

TK1 antibody

Sign In for Pricing
View Details
Paxillin (Tyr-118), Phosphospecific Antibody
bs-70596R 100 µL

Paxillin (Tyr-118), Phosphospecific Antibody

Sign In for Pricing
View Details
Human Rab effector MyRIP, MYRIP ELISA Kit
MBS9318650-01 48 Well

Human Rab effector MyRIP, MYRIP ELISA Kit

Sign In for Pricing
View Details
Human Rab effector MyRIP, MYRIP ELISA Kit
MBS9318650-02 96 Well

Human Rab effector MyRIP, MYRIP ELISA Kit

Sign In for Pricing
View Details
Human Rab effector MyRIP, MYRIP ELISA Kit
MBS9318650-03 5x 96 Well

Human Rab effector MyRIP, MYRIP ELISA Kit

Sign In for Pricing
View Details
Human Rab effector MyRIP, MYRIP ELISA Kit
MBS9318650-04 10x 96 Well

Human Rab effector MyRIP, MYRIP ELISA Kit

Sign In for Pricing
View Details