Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming Growth Factor - alpha

Product Specifications

Background

TGF-alpha was originally isolated from the conditioned media of oncogenically transformed cells as an EGF-like bioactivity. TGF-alpha is a member of the EGF family of cytokines that are synthesized as transmembrane precursors and are characterized by the presence of one or several EGF structural units in their extracellular domain. The soluble forms of these cytokines are released from the transmembrane protein by proteolytic cleavage. Membrane-bound proTGF-alpha is biologically active and seems to play a role in mediation of cell-cell adhesion and in juxtacrine stimulation of adjacent cells. Expression of TGF-alpha is widespread in tumors and transformed cells. TGF-alpha is also expressed in normal tissues during embryogenesis and in adult tissues, including pituitary, brain, keratinocytes and macrophages. Mature TGF-alpha shows approximately 93% amino acid sequence identity with mouse or rat TGF-alpha and is not species specific in its biological effects. TGF-alpha binds to the EGF receptor and activates the receptor tyrosine kinase. Accordingly, TGF-alpha shows a similar potency to EGF as a mitogen for fibroblasts and as an inducer of epithelial development in vivo. TGF-alpha is reportedly more potent than EGF as an angiogenic factor in vivo and as a stimulator for keratinocyte migration. The EGF receptor gene represents the cellular homologue of the avian v-erb-B oncogene.

Target

MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Purification

>95% by SDS-PAGE analyses.

Endotoxin

Less than 0.1 EU/ug of rHuTGF-α as determined by LAL method.

Bioactivity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1-0.4 ng/ml.

Storage Conditions

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.

Calculated Molecular Weight

Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.

Formulation

Lyophilized from 0.2 μm filtered concentrated solution in Acetonitrile and TFA.

Host or Source

Escherichia coli

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP Conjugated Antibody
C33778 100 µL

YAP Conjugated Antibody

Sign In for Pricing
View Details
Anti-Rel B/RELB Antibody Picoband® Fluoro594 Conjugated
PB9799-Fluoro594 100 µg/Vial

Anti-Rel B/RELB Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
TLR4 Rabbit Polyclonal Antibody (BF405)
orb1605837 100 µL

TLR4 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
RT1-S3 Rat shRNA Plasmid (Locus ID 294228)
TL701159 1 Kit

RT1-S3 Rat shRNA Plasmid (Locus ID 294228)

Sign In for Pricing
View Details
Ctip2/BCL11B Rabbit Polyclonal Antibody (APC)
orb2595426 100 µg

Ctip2/BCL11B Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Human CD120B/TNFRSF1B Protein, His Tag
E40KMH296 20 µg

Recombinant Human CD120B/TNFRSF1B Protein, His Tag

Sign In for Pricing
View Details