Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Rat (P. pastoris, His)

MMP-2 is a multifunctional metalloproteinase that plays multiple roles in vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, MMP-2 also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Rat (P. pastoris, His) is the recombinant rat-derived MMP-2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-rat-p-pastoris-his.html

Purity

90.00

Smiles

YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

81686 (Gene_ID) P33436 (Y110-C662) (Accession)

Molecular Weight

67 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β I tubulin Mouse Monoclonal Antibody(Zebrafish Specific)
RA10392-01 50 µL

β I tubulin Mouse Monoclonal Antibody(Zebrafish Specific)

Sign In for Pricing
View Details
β I tubulin Mouse Monoclonal Antibody(Zebrafish Specific)
RA10392-02 100 µL

β I tubulin Mouse Monoclonal Antibody(Zebrafish Specific)

Sign In for Pricing
View Details
LONRF3 (NM_001031855) Human Over-expression Lysate
LH19907V 100 µg

LONRF3 (NM_001031855) Human Over-expression Lysate

Sign In for Pricing
View Details
KLRC1 Antibody
63-556 200 µL

KLRC1 Antibody

Sign In for Pricing
View Details
Mouse Wdr25 (NM_177602) AAV Particle
MR213767A1V 250 µL

Mouse Wdr25 (NM_177602) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal MEF2D Antibody (PCRP-MEF2D-3A4) [PE]
NBP3-14120PE 0.1 mL

Mouse Monoclonal MEF2D Antibody (PCRP-MEF2D-3A4) [PE]

Sign In for Pricing
View Details