Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Human (HEK293, His)

The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (HEK293, His) is the recombinant human-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-human-hek293-his.html

Purity

97.00

Smiles

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Molecular Formula

975 (Gene_ID) P60033 (F113-K201) (Accession)

Molecular Weight

10-13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF568 conjugate, 0.1mg/mL
BNC682145-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF647 conjugate, 0.1mg/mL
BNC470950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 (LFA2/600), CF740 conjugate, 0.1mg/mL
BNC740600-500 1x 500 µL

CD2 (LFA2/600), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF640R conjugate, 0.1mg/mL
BNC401082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details