Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Human (HEK293, His)

The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (HEK293, His) is the recombinant human-derived CD81 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-human-hek293-his.html

Purity

97.00

Smiles

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Molecular Formula

975 (Gene_ID) P60033 (F113-K201) (Accession)

Molecular Weight

10-13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit
KTE60442-01 48 Tests

Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit

Sign In for Pricing
View Details
Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit
KTE60442-02 96 Tests

Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit

Sign In for Pricing
View Details
Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit
KTE60442-03 5x 96 Tests

Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit

Sign In for Pricing
View Details
Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit
KTE60442-04 50x 96 Tests

Human Synaptotagmin-like protein 2 (SYTL2) ELISA Kit

Sign In for Pricing
View Details
AKT Antibody: ATTO 594
MBS8001637-01 0.1 mg

AKT Antibody: ATTO 594

Sign In for Pricing
View Details
AKT Antibody: ATTO 594
MBS8001637-02 5x 0.1 mg

AKT Antibody: ATTO 594

Sign In for Pricing
View Details