Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUSTN1, Human (His)

The MUSTN1 protein emerged as a potential regulator of musculoskeletal development and regeneration, coordinating key molecular events. Its specificity highlights its role in the complex signaling pathways that control musculoskeletal tissue. MUSTN1 Protein, Human (His) is the recombinant human-derived MUSTN1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

MUSTN1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mustn1-protein-human-his.html

Purity

98.0

Smiles

MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG

Molecular Formula

389125 (Gene_ID) Q8IVN3 (M1-G82) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin3 antibody
MBS200406-01 0.05 mL

Peroxiredoxin3 antibody

Sign In for Pricing
View Details
Peroxiredoxin3 antibody
MBS200406-02 0.1 mL

Peroxiredoxin3 antibody

Sign In for Pricing
View Details
Peroxiredoxin3 antibody
MBS200406-03 5x 0.05 mL

Peroxiredoxin3 antibody

Sign In for Pricing
View Details
Peroxiredoxin3 antibody
MBS200406-04 5x 0.1 mL

Peroxiredoxin3 antibody

Sign In for Pricing
View Details
Tert-Butyl ((1S,3S) -1- ((2S,4S) -4-isopropyl-5-oxotetrahydrofuran-2-yl) -3- (4-methoxy-3- (3-methoxypropoxy) benzyl) -4-methylpentyl) carbamate
OR1070473-01 250 mg

Tert-Butyl ((1S,3S) -1- ((2S,4S) -4-isopropyl-5-oxotetrahydrofuran-2-yl) -3- (4-methoxy-3- (3-methoxypropoxy) benzyl) -4-methylpentyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl ((1S,3S) -1- ((2S,4S) -4-isopropyl-5-oxotetrahydrofuran-2-yl) -3- (4-methoxy-3- (3-methoxypropoxy) benzyl) -4-methylpentyl) carbamate
OR1070473-02 5 g

Tert-Butyl ((1S,3S) -1- ((2S,4S) -4-isopropyl-5-oxotetrahydrofuran-2-yl) -3- (4-methoxy-3- (3-methoxypropoxy) benzyl) -4-methylpentyl) carbamate

Sign In for Pricing
View Details