Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUSTN1, Human (His)

The MUSTN1 protein emerged as a potential regulator of musculoskeletal development and regeneration, coordinating key molecular events. Its specificity highlights its role in the complex signaling pathways that control musculoskeletal tissue. MUSTN1 Protein, Human (His) is the recombinant human-derived MUSTN1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

MUSTN1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mustn1-protein-human-his.html

Purity

98.0

Smiles

MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG

Molecular Formula

389125 (Gene_ID) Q8IVN3 (M1-G82) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (AP) discontinued
247633-AP 100 µL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (AP) discontinued

Ask
View Details
Frozen Tissue Sections, Colon
CS631210 5x 5 µm

Frozen Tissue Sections, Colon

Ask
View Details
GBP3, CT (GBP3, Guanylate-binding protein 3, GTP-binding protein 3, Guanine nucleotide-binding protein 3)
035940 200 µL

GBP3, CT (GBP3, Guanylate-binding protein 3, GTP-binding protein 3, Guanine nucleotide-binding protein 3)

Ask
View Details