Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sphingomyelin Synthase 2/SGMS2, Human (HEK293, Fc)

The sphingomyelin synthase 2 (SGMS2) protein plays a crucial role in plasma membrane sphingomyelin synthesis. It catalyzes the reversible transfer of the phosphocholine moiety in sphingomyelin biosynthesis to form ceramide phosphocholine. Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc) is the recombinant human-derived Sphingomyelin Synthase 2/SGMS2 protein, expressed by HEK293 , with N-mFc labeled tag.

Product Specifications

Product Name Alternative

Sphingomyelin Synthase 2/SGMS2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sphingomyelin-synthase-2-sgms2-protein-human-hek293-fc.html

Purity

96.58

Smiles

MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKT

Molecular Formula

166929 (Gene_ID) Q8NHU3 (M1-T79) (Accession)

Molecular Weight

Approximately 35.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA2 Monoclonal Antibody
A10252-100UL 100 µL

HSPA2 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-TIAR Purified
30-2710-0.1 0.1 mg

Anti-TIAR Purified

Sign In for Pricing
View Details
C11orf49 293 Cell Lysate
405691 0.1 mg

C11orf49 293 Cell Lysate

Sign In for Pricing
View Details
Fructose-6-Phosphate Kinase (Biotin) discontinued
F8060-10A 100 µg

Fructose-6-Phosphate Kinase (Biotin) discontinued

Sign In for Pricing
View Details
Anti-Transgelin 2 (TAGLN2)
FY-AB45655-01 1 mL

Anti-Transgelin 2 (TAGLN2)

Sign In for Pricing
View Details
Anti-Transgelin 2 (TAGLN2)
FY-AB45655-02 100 µL

Anti-Transgelin 2 (TAGLN2)

Sign In for Pricing
View Details