Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TL1A/TNFSF15, Cynomolgus/Rhesus macaque (HEK293, His)

The TL1A/TNFSF15 protein is an important member of the tumor necrosis factor family and is critical for immune regulation and cellular responses. Its study enhances our understanding of immune regulation, providing potential applications for immunoassay and therapeutic development. TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived TL1A/TNFSF15 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His), Rhesus Macaque; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tl1a-tnfsf15-trimer-protein-cynomolgus-rhesus-macaque-hek293-his-solutin.html

Purity

95.00

Smiles

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Formula

102144578 (Gene_ID) F6S8F9-1/A0A2K5UA22 (L72-L251) (Accession)

Molecular Weight

Approximately 24-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL
BNC471091-100 1x 100 µL

PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details