SECTM1, Human (HEK293, His)
SECTM1 Protein potentially influences thymocyte signaling, indicating a role in thymic regulatory mechanisms. Its interaction with CD7 suggests involvement in cellular processes, potentially influencing thymocyte-associated signaling pathways. SECTM1's significance in thymocyte function and interaction with CD7 hints at a role in modulating immune responses and cellular communication within the thymic microenvironment. SECTM1 Protein, Human (HEK293, His) is the recombinant human-derived SECTM1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
SECTM1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sectm1-protein-human-hek-293-his.html
Purity
98.0
Smiles
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
Molecular Formula
6398 (Gene_ID) Q8WVN6 (Q29-G145) (Accession)
Molecular Weight
18-22 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HCG-beta (HCGb/54+ HCGb/459), CF660R conjugate, 0.1mg/mL
CD79a (IGA/764), CF405S conjugate, 0.1mg/mL
Cytokeratin 7 (K72.7), CF568 conjugate, 0.1mg/mL
Ep-CAM / CD326 (EGP40/1120), CF594 conjugate, 0.1mg/mL
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF568 conjugate, 0.1mg/mL
