Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC5A/MDL-1, Rat (HEK293, His)

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC5A/MDL-1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec5a-mdl-1-protein-rat-hek293-his.html

Purity

98.0

Smiles

VFGKSSDGFIPTESYGTTNVQNVSQIFGRSDESFVPTRSSGTACPNNWDFHQGRCFFFSTSESPWKNSRDYCATKGSTLAIVDTPKKLKFLQDRAGAENYFIGLIRQPGEKKWRWVNNSVFKGNVTNQEQNFNCVTIGLTMTFDAASCDISYRWICETTPK

Molecular Formula

679787 (Gene_ID) D3ZPN6 (V30-K190) (Accession)

Molecular Weight

Approximately 28-39 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details