Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC5A/MDL-1, Rat (HEK293, His)

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC5A/MDL-1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec5a-mdl-1-protein-rat-hek293-his.html

Purity

98.0

Smiles

VFGKSSDGFIPTESYGTTNVQNVSQIFGRSDESFVPTRSSGTACPNNWDFHQGRCFFFSTSESPWKNSRDYCATKGSTLAIVDTPKKLKFLQDRAGAENYFIGLIRQPGEKKWRWVNNSVFKGNVTNQEQNFNCVTIGLTMTFDAASCDISYRWICETTPK

Molecular Formula

679787 (Gene_ID) D3ZPN6 (V30-K190) (Accession)

Molecular Weight

Approximately 28-39 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM72 (Tripartite Motif-containing Protein 72, Mitsugumin-53, Mg53, MG53) (AP) discontinued
134771-AP 100 µL

TRIM72 (Tripartite Motif-containing Protein 72, Mitsugumin-53, Mg53, MG53) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Uncharacterized protein jhp_0507 (jhp_0507), partial
MBS1257314-01 1 mg (E-Coli)

Recombinant Helicobacter pylori Uncharacterized protein jhp_0507 (jhp_0507), partial

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Uncharacterized protein jhp_0507 (jhp_0507), partial
MBS1257314-02 1 mg (Yeast)

Recombinant Helicobacter pylori Uncharacterized protein jhp_0507 (jhp_0507), partial

Sign In for Pricing
View Details
RAVER2 Rabbit Monoclonal Antibody [Clone ID: R09-6H8]
TA422107 100 µL

RAVER2 Rabbit Monoclonal Antibody [Clone ID: R09-6H8]

Sign In for Pricing
View Details
APC anti-human CD195 (CCR5)
GT14076 100 Tests

APC anti-human CD195 (CCR5)

Sign In for Pricing
View Details
GGA1 Antibody
DF14339-01 100 µL

GGA1 Antibody

Sign In for Pricing
View Details