Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTF, Rat

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Rat is produced by E. coli with tag freeg.

Product Specifications

Product Name Alternative

CNTF Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cntf-protein-rat.html

Purity

95.0

Smiles

AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

Molecular Formula

25707 (Gene_ID) P20294 (A2-M200) (Accession)

Molecular Weight

Approximately 22.9 kDa

References & Citations

[1]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[2]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[3]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[4]Saadat S, et al. Ciliary neurotrophic factor induces cholinergic differentiation of rat sympathetic neurons in culture[J]. The Journal of cell biology, 1989, 108 (5) : 1807-1816.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[SP-4-2-(1R-trans)]-(1,2-Cyclohexanediamine-κN,κN') Diiodoplatinum
TRC-C984525-250MG 250 mg

[SP-4-2-(1R-trans)]-(1,2-Cyclohexanediamine-κN,κN') Diiodoplatinum

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]
AN00567H-01 50 Tests

PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]
AN00567H-02 100 Tests

PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]
AN00567H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details
Streptozotocin
TRC-S687550-250MG 250 mg

Streptozotocin

Sign In for Pricing
View Details
PD-L1 Antibody
OC-282-01 50 μL

PD-L1 Antibody

Sign In for Pricing
View Details