CNTF, Rat
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Rat is produced by E. coli with tag freeg.
Product Specifications
Product Name Alternative
CNTF Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cntf-protein-rat.html
Purity
95.0
Smiles
AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Molecular Formula
25707 (Gene_ID) P20294 (A2-M200) (Accession)
Molecular Weight
Approximately 22.9 kDa
References & Citations
[1]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[2]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[3]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[4]Saadat S, et al. Ciliary neurotrophic factor induces cholinergic differentiation of rat sympathetic neurons in culture[J]. The Journal of cell biology, 1989, 108 (5) : 1807-1816.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Monoclonal Peroxiredoxin 4 Antibody (SAIC-40A-24) [mFluor Violet 610 SE]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP3-20105MFV610 0.1 mL
Rabbit Monoclonal Peroxiredoxin 4 Antibody (SAIC-40A-24) [mFluor Violet 610 SE]
Sign In for Pricing
View Details 
MBS9900359-01 48 Well
Human Thymocyte Globulin Antibody (Anti-TG) ELISA Kit
Sign In for Pricing
View Details