Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXT, Human (P.pastoris, His)

OXT, or oxytocin, induces physiological effects by binding to neurophysin 1 and interacting with the oxytocin receptor (OXTR) . This interaction results in smooth muscle contraction in the uterus and mammary gland, crucial for labor and breastfeeding, respectively, by modulating OXTR activity. OXT Protein, Human (P.pastoris, His) is the recombinant human-derived OXT protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

OXT Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/oxt-protein-human-p-pastoris-his.html

Purity

93.00

Smiles

AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Molecular Formula

5020 (Gene_ID) P01178 (A32-R125) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Human HLA-A*02:01&B2M&HER2 (LIAHNQVRQV) Complex Protein (Monomer, MALS verified)
HL2-H82E3-25ug 25 µg

Biotinylated Human HLA-A*02:01&B2M&HER2 (LIAHNQVRQV) Complex Protein (Monomer, MALS verified)

Sign In for Pricing
View Details
Beta Arrestin 1 Recombinant Antibody
bsm-61185R-TR 20 µL

Beta Arrestin 1 Recombinant Antibody

Sign In for Pricing
View Details
MPV17L2 HDR Plasmid (h)
sc-410209-HDR 20 µg

MPV17L2 HDR Plasmid (h)

Sign In for Pricing
View Details
Ghsr 3'UTR GFP Stable Cell Line
TU157050 1.0 mL

Ghsr 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MX1 Rabbit Polyclonal Antibody (AP)
orb958664 100 µL

MX1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Rabbit anti-FOXO4 (pS197) Antibody
DL90743A-01 50 µL

Rabbit anti-FOXO4 (pS197) Antibody

Sign In for Pricing
View Details