Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD105/Endoglin, Mouse (HEK293, His, solution)

CD105/Endoglin is an important endothelial glycoprotein that controls angiogenesis and ensures the structural integrity of the adult vasculature. It affects vascular endothelial cell migration and has important implications for extraembryonic and embryonic heart development. CD105/Endoglin Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD105/Endoglin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD105/Endoglin Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd105-endoglin-protein-mouse-hek293-his.html

Purity

96.70

Smiles

MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

Molecular Formula

13805 (Gene_ID) Q63961 (R28-G581) (Accession)

Molecular Weight

65-70 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem140 (NM_001009709) Rat Untagged Clone
RN202043 10 µg

Tmem140 (NM_001009709) Rat Untagged Clone

Sign In for Pricing
View Details
Rab24 (NM_009000) Mouse Tagged ORF Clone Lentiviral Particle
MR202107L4V 200 µL

Rab24 (NM_009000) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Histone H3 (mono methyl K79) Monoclonal Antibody, HRP Conjugated
bsm-33105M-HRP 100 µL

Histone H3 (mono methyl K79) Monoclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
RASA4B CRISPR Activation Plasmid (h)
sc-418861-ACT 20 µg

RASA4B CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MFluor™ Red 780 Anti-human CD58 Antibody *HI58a*
105800W1-AAT 500 Tests

MFluor™ Red 780 Anti-human CD58 Antibody *HI58a*

Sign In for Pricing
View Details
WNT10A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50444066 1.0 µg DNA

WNT10A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details