Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD105/Endoglin, Mouse (HEK293, His, solution)

CD105/Endoglin is an important endothelial glycoprotein that controls angiogenesis and ensures the structural integrity of the adult vasculature. It affects vascular endothelial cell migration and has important implications for extraembryonic and embryonic heart development. CD105/Endoglin Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD105/Endoglin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD105/Endoglin Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd105-endoglin-protein-mouse-hek293-his.html

Purity

96.70

Smiles

MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

Molecular Formula

13805 (Gene_ID) Q63961 (R28-G581) (Accession)

Molecular Weight

65-70 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Anti-NLRP3 Antibody
TA349228 100 µL

Rabbit Polyclonal Anti-NLRP3 Antibody

Sign In for Pricing
View Details
Human Chorionic Gonadotropin-Immunoglobulin G (HCG-IgG) BioAssayTM ELISA Kit (Human) discontinued
587682 96 Tests

Human Chorionic Gonadotropin-Immunoglobulin G (HCG-IgG) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Cuscohygrine-d6 (mixture of diastereomers)
HY-W777700-01 1 mg

Cuscohygrine-d6 (mixture of diastereomers)

Sign In for Pricing
View Details
Cuscohygrine-d6 (mixture of diastereomers)
HY-W777700-02 10 mg

Cuscohygrine-d6 (mixture of diastereomers)

Sign In for Pricing
View Details
Anti-TMEFF2 Mouse Monoclonal Antibody [Clone ID: OTI1F9]
M03846 100 µL

Anti-TMEFF2 Mouse Monoclonal Antibody [Clone ID: OTI1F9]

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) Protein S100-A10 (S100A10)
MBS950103-01 1 mg (E-Coli)

Recombinant Macaca mulatta (Rhesus macaque) Protein S100-A10 (S100A10)

Sign In for Pricing
View Details