Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD105/Endoglin, Mouse (HEK293, His, solution)

CD105/Endoglin is an important endothelial glycoprotein that controls angiogenesis and ensures the structural integrity of the adult vasculature. It affects vascular endothelial cell migration and has important implications for extraembryonic and embryonic heart development. CD105/Endoglin Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived CD105/Endoglin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD105/Endoglin Protein, Mouse (HEK293, His, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd105-endoglin-protein-mouse-hek293-his.html

Purity

96.70

Smiles

MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

Molecular Formula

13805 (Gene_ID) Q63961 (R28-G581) (Accession)

Molecular Weight

65-70 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE28 siRNA Oligos set (Human)
51233171 3x 5 nmol

ZFYVE28 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Cat Cubilin ELISA Kit
MBS073998 Inquire

Cat Cubilin ELISA Kit

Sign In for Pricing
View Details
17-Ketosteroids (17-KS) Mouse ELISA Kit
B0244 96 Tests

17-Ketosteroids (17-KS) Mouse ELISA Kit

Sign In for Pricing
View Details
Olfr207 Protein Vector (Mouse) (pPB-C-His)
PV209818 500 ng

Olfr207 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
VIM (Vimentin, FLJ36605) (FITC)
MBS6443197-01 0.1 mL

VIM (Vimentin, FLJ36605) (FITC)

Sign In for Pricing
View Details
VIM (Vimentin, FLJ36605) (FITC)
MBS6443197-02 5x 0.1 mL

VIM (Vimentin, FLJ36605) (FITC)

Sign In for Pricing
View Details