Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Mouse (His)

Leptin is a key regulator of energy balance and body weight and binds to LEPR receptors in multiple tissues.It controls appetite in the hypothalamus and affects bone mass, hormone regulation, and reproductive function.Leptin Protein, Mouse (His) is the recombinant mouse-derived Leptin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Leptin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-mouse-his.html

Purity

98.0

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Formula

16846 (Gene_ID) Q544U0 (V22-C167) (Accession)

Molecular Weight

Approximately 16-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,N4-Etheno-2'-deoxycytidine-13C,15N2
TRC-E677902-2.5MG 2.5 mg

3,N4-Etheno-2'-deoxycytidine-13C,15N2

Sign In for Pricing
View Details
CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL
BNC040748-500 1x 500 µL

CD5 (C5/473 + CD5/54/F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCNT7 (NM_001128614) Human Over-expression Lysate
LC426976 20 µg

GCNT7 (NM_001128614) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXI3 Goat Polyclonal Antibody
AP33415PU-N 100 µg

FOXI3 Goat Polyclonal Antibody

Sign In for Pricing
View Details
USP12 (C-term) Rabbit Polyclonal Antibody
AP12026PU-N 400 µL

USP12 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGA1 Rabbit Polyclonal Antibody
TA376554 100 µL

GGA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details