Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Mouse (His)

Leptin is a key regulator of energy balance and body weight and binds to LEPR receptors in multiple tissues.It controls appetite in the hypothalamus and affects bone mass, hormone regulation, and reproductive function.Leptin Protein, Mouse (His) is the recombinant mouse-derived Leptin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Leptin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-mouse-his.html

Purity

98.0

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Formula

16846 (Gene_ID) Q544U0 (V22-C167) (Accession)

Molecular Weight

Approximately 16-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doxofylline
TRC-D557100-5G 5 g

Doxofylline

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF488A conjugate, 0.1mg/mL
BNC883632-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apobec3 Mouse Gene Knockout Kit (CRISPR)
KN301413RB 1 Kit

Apobec3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-epi-Moxidectin
TRC-M744805-2.5MG 2.5 mg

2-epi-Moxidectin

Sign In for Pricing
View Details
Protein A TRITC Colloidal Gold, 1mL 10nm
RGP-01-10 1 mL

Protein A TRITC Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details