Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Mouse (His)

Leptin is a key regulator of energy balance and body weight and binds to LEPR receptors in multiple tissues.It controls appetite in the hypothalamus and affects bone mass, hormone regulation, and reproductive function.Leptin Protein, Mouse (His) is the recombinant mouse-derived Leptin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Leptin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-mouse-his.html

Purity

98.0

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Formula

16846 (Gene_ID) Q544U0 (V22-C167) (Accession)

Molecular Weight

Approximately 16-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+)-Anymol
TRC-A697863-1MG 1 mg

(+)-Anymol

Sign In for Pricing
View Details
Recombinant Human TEM7/PLXDC1 Protein (His Tag)
PKSH032908-01 10 µg

Recombinant Human TEM7/PLXDC1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TEM7/PLXDC1 Protein (His Tag)
PKSH032908-02 50 µg

Recombinant Human TEM7/PLXDC1 Protein (His Tag)

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF647 conjugate, 0.1mg/mL
BNC471099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details