Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Mouse (His)

Leptin is a key regulator of energy balance and body weight and binds to LEPR receptors in multiple tissues.It controls appetite in the hypothalamus and affects bone mass, hormone regulation, and reproductive function.Leptin Protein, Mouse (His) is the recombinant mouse-derived Leptin protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Leptin Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-mouse-his.html

Purity

98.0

Smiles

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Formula

16846 (Gene_ID) Q544U0 (V22-C167) (Accession)

Molecular Weight

Approximately 16-18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human SPRR2B Over-expressing Stable Cell Line
ABC-X2977 1 Vial

Xpress™ Human SPRR2B Over-expressing Stable Cell Line

Sign In for Pricing
View Details
SHANK1 Antibody
MBS7128170-01 0.05 mL

SHANK1 Antibody

Sign In for Pricing
View Details
SHANK1 Antibody
MBS7128170-02 0.1 mL

SHANK1 Antibody

Sign In for Pricing
View Details
SHANK1 Antibody
MBS7128170-03 5x 0.1 mL

SHANK1 Antibody

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF740 conjugate, 0.1mg/mL
BNC740967-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VOC 12-Dichloroethane Neat - 10MG
REVOC112N 10 mg

VOC 12-Dichloroethane Neat - 10MG

Sign In for Pricing
View Details