Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lgals12 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3245804 1.0 µg DNA

Lgals12 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Vmn1r32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4032807 1.0 µg DNA

Vmn1r32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-ADH1B Mouse Monoclonal Antibody
B2020948 100 µL

Anti-ADH1B Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Arthrobacter chlorophenolicus ATP synthase subunit delta (atpH)
MBS1032179-01 0.02 mg (E-Coli)

Recombinant Arthrobacter chlorophenolicus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Arthrobacter chlorophenolicus ATP synthase subunit delta (atpH)
MBS1032179-02 0.02 mg (Yeast)

Recombinant Arthrobacter chlorophenolicus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Arthrobacter chlorophenolicus ATP synthase subunit delta (atpH)
MBS1032179-03 0.1 mg (E-Coli)

Recombinant Arthrobacter chlorophenolicus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details