Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF568 conjugate, 0.1mg/mL
BNC681922-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF488A conjugate, 0.1mg/mL
BNC881825-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF405S conjugate, 0.1mg/mL
BNC042747-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details