Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm9376 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3081403 1.0 µg DNA

Gm9376 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Agpat1 Mouse Gene Knockout Kit (CRISPR)
KN500985 1 Kit

Agpat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nufip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7413506 1.0 µg DNA

Nufip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal RhoH Antibody (3D3)
H00000399-M03 0.1 mg

Mouse Monoclonal RhoH Antibody (3D3)

Sign In for Pricing
View Details
PDCD1/PD-1/CD279 (ezabenlimab) discontinued
048230 100 µg

PDCD1/PD-1/CD279 (ezabenlimab) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [FITC]
NBP2-47812F 0.1 mL

Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [FITC]

Sign In for Pricing
View Details