Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3I Rabbit Polyclonal Antibody
JOT-AP09559-01 50ul

EIF3I Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF3I Rabbit Polyclonal Antibody
JOT-AP09559-02 100ul

EIF3I Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHF5A (PHD Finger Protein 5A, INI, MGC1346, SF3b14b, bK223H9.2) (APC)
MBS6170263-01 0.1 mL

PHF5A (PHD Finger Protein 5A, INI, MGC1346, SF3b14b, bK223H9.2) (APC)

Sign In for Pricing
View Details
PHF5A (PHD Finger Protein 5A, INI, MGC1346, SF3b14b, bK223H9.2) (APC)
MBS6170263-02 5x 0.1 mL

PHF5A (PHD Finger Protein 5A, INI, MGC1346, SF3b14b, bK223H9.2) (APC)

Sign In for Pricing
View Details
VASP (NM_003370) Human Tagged Lenti ORF Clone
RC203544L3 10 µg

VASP (NM_003370) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bisoctrizole
MBS3840713-01 100 mg

Bisoctrizole

Sign In for Pricing
View Details