Animal-Free IL-22, Human (His)
Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-22 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html
Purity
95.00
Smiles
MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Molecular Formula
50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PAEP, ID (PAEP, Glycodelin, Placental protein 14, Pregnancy-associated endometrial alpha-2 globulin, Progestagen-associated endometrial protein, Progesterone-associated endometrial protein)
Polyclonal Antibody to Histone Cluster 3, H2a (HIST3H2A)
Polyclonal Antibody to Histone Cluster 3, H2a (HIST3H2A)
Polyclonal Antibody to Histone Cluster 3, H2a (HIST3H2A)
Polyclonal Antibody to Histone Cluster 3, H2a (HIST3H2A)