Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF9 Cell-Based ELISA
CB5890 1 Kit

TNFSF9 Cell-Based ELISA

Sign In for Pricing
View Details
Rabbit Polyclonal PIEZO2 Antibody [DyLight 405]
NBP1-78538V 0.1 mL

Rabbit Polyclonal PIEZO2 Antibody [DyLight 405]

Sign In for Pricing
View Details
Prkd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6570908 1.0 µg DNA

Prkd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TRPM3 (Transient receptor potential cation channel subfamily M member 3) Full Length
MPC0964K Each

Magic™ Membrane Protein Human TRPM3 (Transient receptor potential cation channel subfamily M member 3) Full Length

Sign In for Pricing
View Details
Rnf128 Mouse siRNA Oligo Duplex (Locus ID 66889)
SR426791 1 Kit

Rnf128 Mouse siRNA Oligo Duplex (Locus ID 66889)

Sign In for Pricing
View Details
Rat soluble Interleukin 2 recepter (IL-2sR) ELISA Kit
QY-E11517 96 Tests

Rat soluble Interleukin 2 recepter (IL-2sR) ELISA Kit

Sign In for Pricing
View Details