Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GSTO2 shRNA (UAS) - Lentiviral human GSTO2 shRNA (UAS) plasmid
GTR15158011 1 Vial

Lentiviral human GSTO2 shRNA (UAS) - Lentiviral human GSTO2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
DEFA5 siRNA (Human)
MBS8208905-01 15 nmol

DEFA5 siRNA (Human)

Sign In for Pricing
View Details
DEFA5 siRNA (Human)
MBS8208905-02 30 nmol

DEFA5 siRNA (Human)

Sign In for Pricing
View Details
DEFA5 siRNA (Human)
MBS8208905-03 5x 30 nmol

DEFA5 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Rat Glutamate receptor, ionotropic kainate 3 (Grik3) , partial
MBS962300-01 1 mg (E-Coli)

Recombinant Rat Glutamate receptor, ionotropic kainate 3 (Grik3) , partial

Sign In for Pricing
View Details
Recombinant Rat Glutamate receptor, ionotropic kainate 3 (Grik3) , partial
MBS962300-02 1 mg (Yeast)

Recombinant Rat Glutamate receptor, ionotropic kainate 3 (Grik3) , partial

Sign In for Pricing
View Details