Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-01 0.01 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-02 0.05 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-03 0.5 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
Recombinant Canine DGKA Protein (Full Length, His Tag), Active
MBS517881-04 5x 0.5 mg

Recombinant Canine DGKA Protein (Full Length, His Tag), Active

Sign In for Pricing
View Details
MHY1485
406654 100.0mg

MHY1485

Sign In for Pricing
View Details
Lentiviral human TCF19 sgRNA gene knockout kit - Lentiviral human TCF19 sgRNA gene knockout kit (plasmid)
GTR15374501 1 Vial

Lentiviral human TCF19 sgRNA gene knockout kit - Lentiviral human TCF19 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details