Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAA11 Protein Vector (Rat) (pPB-C-His)
PV284186 500 ng

NAA11 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
LGALS1 Polyclonal Antibody
CAC13100-01 50 µg

LGALS1 Polyclonal Antibody

Sign In for Pricing
View Details
LGALS1 Polyclonal Antibody
CAC13100-02 100 µg

LGALS1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Muscleblind-like 1 Antibody
NBP2-55165-25ul 25 µL

Rabbit Polyclonal Muscleblind-like 1 Antibody

Sign In for Pricing
View Details
ONO-8130
HY-110198 1 mg

ONO-8130

Sign In for Pricing
View Details
African Green Monkey PBMC
B2014553 10^6 Cells/Vial

African Green Monkey PBMC

Sign In for Pricing
View Details