Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBAP2, NT (UBAP2, KIAA1491, Ubiquitin-associated protein 2) (APC)
MBS6360586-01 0.2 mL

UBAP2, NT (UBAP2, KIAA1491, Ubiquitin-associated protein 2) (APC)

Sign In for Pricing
View Details
UBAP2, NT (UBAP2, KIAA1491, Ubiquitin-associated protein 2) (APC)
MBS6360586-02 5x 0.2 mL

UBAP2, NT (UBAP2, KIAA1491, Ubiquitin-associated protein 2) (APC)

Sign In for Pricing
View Details
Chicken COMT ELISA Kit
E108019 1 Each

Chicken COMT ELISA Kit

Sign In for Pricing
View Details
VMO1 AAV Vector (Mouse) (CMV)
49847104 1 µg

VMO1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
APOC4 polyclonal antibody
BS60500-01 50 µL

APOC4 polyclonal antibody

Sign In for Pricing
View Details
APOC4 polyclonal antibody
BS60500-02 100 µL

APOC4 polyclonal antibody

Sign In for Pricing
View Details