Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC689600 (NM_001106351) Rat Tagged ORF Clone Lentiviral Particle
RR214236L4V 200 µL

LOC689600 (NM_001106351) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-PRKCD Rabbit Polyclonal Antibody
TA322965 100 µL

Anti-PRKCD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMED7-TICAM2 CRISPR Knock Out 293T Cell Line (Human)
46848141 1x 10^6 Cells / 1.0 mL

TMED7-TICAM2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ATP5C1 Protein Vector (Human) (pPM-N-D-C-His)
PV325113 500 ng

ATP5C1 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
RNF219, ID (RNF219, C13orf7, RING finger protein 219) (MaxLight 650)
MBS6342849-01 0.1 mL

RNF219, ID (RNF219, C13orf7, RING finger protein 219) (MaxLight 650)

Sign In for Pricing
View Details
RNF219, ID (RNF219, C13orf7, RING finger protein 219) (MaxLight 650)
MBS6342849-02 5x 0.1 mL

RNF219, ID (RNF219, C13orf7, RING finger protein 219) (MaxLight 650)

Sign In for Pricing
View Details