Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cbl rabbit pAb
ES1876-01 50 µL

Cbl rabbit pAb

Sign In for Pricing
View Details
Cbl rabbit pAb
ES1876-02 100 µL

Cbl rabbit pAb

Sign In for Pricing
View Details
TRIM28 Protein Vector (Human) (pPB-C-His)
PV137942 500 ng

TRIM28 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Dnaja4 qPCR Primer Pair
QM29914S 200 Tests

Mouse Dnaja4 qPCR Primer Pair

Sign In for Pricing
View Details
IgG, Rabbit (FITC)
MBS655014-01 1 mg

IgG, Rabbit (FITC)

Sign In for Pricing
View Details
IgG, Rabbit (FITC)
MBS655014-02 5x 1 mg

IgG, Rabbit (FITC)

Sign In for Pricing
View Details