Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHPT1 sgRNA CRISPR Lentivector set (Human)
K0447401 3x 1.0 µg

CHPT1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lysostaphin, Recombinant
209070 1 mg

Lysostaphin, Recombinant

Sign In for Pricing
View Details
Mouse Neurofilament, Light Polypeptide (NEFL) ELISA Kit
EKU10166 96 Tests

Mouse Neurofilament, Light Polypeptide (NEFL) ELISA Kit

Sign In for Pricing
View Details
6-Alpha-D-Glucopyranosyl Maltotriose
TRC-G419100-10MG 10 mg

6-Alpha-D-Glucopyranosyl Maltotriose

Sign In for Pricing
View Details
Anti-CD62P Polyclonal Antibody 2
MF-0070196-01 50 µL

Anti-CD62P Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-CD62P Polyclonal Antibody 2
MF-0070196-02 100 µL

Anti-CD62P Polyclonal Antibody 2

Sign In for Pricing
View Details