Animal-Free IL-22, Human (His)
Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-22 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html
Purity
95.00
Smiles
MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Molecular Formula
50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Cat Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
C19orf23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4), Partial
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4), Partial
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 4 (Tnfrsf4), Partial