Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

p47 phox Colorimetric Cell-Based ELISA Kit
MBS9500445-01 1 Kit

p47 phox Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
p47 phox Colorimetric Cell-Based ELISA Kit
MBS9500445-02 5x 1 Kit

p47 phox Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
EEF1AL4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0655603 1.0 µg DNA

EEF1AL4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MARS2 (NM_138395) Human Recombinant Protein
TP324966 20 µg

MARS2 (NM_138395) Human Recombinant Protein

Sign In for Pricing
View Details
Eukaryotic Taq Polymerase (Taq), Recombinant, Pan Species
057591-01 10 µg

Eukaryotic Taq Polymerase (Taq), Recombinant, Pan Species

Sign In for Pricing
View Details
Eukaryotic Taq Polymerase (Taq), Recombinant, Pan Species
057591-02 50 µg

Eukaryotic Taq Polymerase (Taq), Recombinant, Pan Species

Sign In for Pricing
View Details