Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified anti-human CD146
GT14237 100 µg

Purified anti-human CD146

Sign In for Pricing
View Details
Ssc5d AAV siRNA Pooled Vector
45536166 1.0 µg

Ssc5d AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Gluconacetobacter diazotrophicus NADH-quinone oxidoreductase subunit N (nuoN), partial
MBS1159305-01 1 mg (E-Coli)

Recombinant Gluconacetobacter diazotrophicus NADH-quinone oxidoreductase subunit N (nuoN), partial

Sign In for Pricing
View Details
Recombinant Gluconacetobacter diazotrophicus NADH-quinone oxidoreductase subunit N (nuoN), partial
MBS1159305-02 1 mg (Yeast)

Recombinant Gluconacetobacter diazotrophicus NADH-quinone oxidoreductase subunit N (nuoN), partial

Sign In for Pricing
View Details
Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody
TA342161 100 µL

Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Galectin-8 / LGALS8 Protein (GST tag)
E53A08161 50 µg

Recombinant Human Galectin-8 / LGALS8 Protein (GST tag)

Sign In for Pricing
View Details