Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM90A24P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV761161 1.0 µg DNA

FAM90A24P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral human CHRD shRNA (UAS) - Lentiviral human CHRD shRNA (UAS, GFP) (100)
GTR15120813 1 Vial

Lentiviral human CHRD shRNA (UAS) - Lentiviral human CHRD shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human PCDHAC2 knockdown cell line
ABC-KD11207 1 Vial

Human PCDHAC2 knockdown cell line

Sign In for Pricing
View Details
IBSP antibody
70R-1687 100 ug

IBSP antibody

Sign In for Pricing
View Details
Lentiviral mouse Klre1 shRNA (UAS) - Lentiviral mouse Klre1 shRNA (UAS, RFP) plasmid
GTR15115021 1 Vial

Lentiviral mouse Klre1 shRNA (UAS) - Lentiviral mouse Klre1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-NDUFB4 Polyclonal Antibody
MF-0081288-01 50 µL

Anti-NDUFB4 Polyclonal Antibody

Sign In for Pricing
View Details