Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-22, Human (His)

Animal-derived-free IL-22 protein is a cytokine that regulates tissue responses during inflammation and contributes to epithelial cell regeneration to maintain barrier function and prevent tissue damage. Animal-Free IL-22 Protein, Human (His) is the recombinant human-derived animal-FreeIL-22 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-22-protein-human-his.html

Purity

95.00

Smiles

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Molecular Formula

50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLT1D1 siRNA (h)
sc-95765 10 µM

GLT1D1 siRNA (h)

Sign In for Pricing
View Details
CST8 (NM_001281730) Human Untagged Clone
SC333889 10 µg

CST8 (NM_001281730) Human Untagged Clone

Sign In for Pricing
View Details
TCF7L1 ORF Vector (Human) (pORF)
ORF033798 1.0 µg DNA

TCF7L1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Zfp703 Protein Vector (Mouse) (pPM-C-His)
PV250073 500 ng

Zfp703 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal SMG1 Antibody [Janelia Fluor 549]
NB100-77278JF549 0.1 mL

Rabbit Polyclonal SMG1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 Protein, N-rFc-tagged
IMP-1852 100 µg

Recombinant Human TNFRSF17 Protein, N-rFc-tagged

Sign In for Pricing
View Details