Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ficolin-1 (Fcn1)

Product Specifications

Product Name Alternative

(Collagen/fibrinogen domain-containing protein 1) (Ficolin-A) (Ficolin-alpha) (M-ficolin)

Abbreviation

Recombinant Mouse Fcn1 protein

Gene Name

Fcn1

UniProt

O70165

Expression Region

18-334aa

Organism

Mus musculus (Mouse)

Target Sequence

SQALGQERGACPDVKVVGLGAQDKVVVIQSCPGFPGPPGPKGEPGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTGAAPSLGEKELGDTLCQRGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDFFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYKLTLGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRYLSGSHESYADGINWGTGQGHHYSYKVAEMKIRAS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8. Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.5 kDa

References & Citations

"Carbohydrate-binding specificities of mouse ficolin A, a splicing variant of ficolin A and ficolin B and their complex formation with MASP-2 and sMAP." Endo Y., Nakazawa N., Liu Y., Iwaki D., Takahashi M., Fujita T., Nakata M., Matsushita M. Immunogenetics 57:837-844 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Acetylcholinesterase (AChE) ELISA Kit
YP-W30995-01 48 Tests

Rat Acetylcholinesterase (AChE) ELISA Kit

Sign In for Pricing
View Details
Rat Acetylcholinesterase (AChE) ELISA Kit
YP-W30995-02 96 Tests

Rat Acetylcholinesterase (AChE) ELISA Kit

Sign In for Pricing
View Details
Human MALL Protein Lysate
MBS8414893-01 0.02 mg

Human MALL Protein Lysate

Sign In for Pricing
View Details
Human MALL Protein Lysate
MBS8414893-02 5x 0.02 mg

Human MALL Protein Lysate

Sign In for Pricing
View Details
Recombinant Human MTHFD1L Protein, N-His
YHK92101 100 μg

Recombinant Human MTHFD1L Protein, N-His

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TMEM169 (Transmembrane protein 169) Full Length
MPC1570K Each

Magic™ Membrane Protein Human TMEM169 (Transmembrane protein 169) Full Length

Sign In for Pricing
View Details