Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Transcription factor bHLH117 (BHLH117)

Product Specifications

CAS Number

9000-83-3

Gene Name

[BHLH117]

NCBI Gene ID

821772

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[AT3G22100; BHLH117; EN140; AtbHLH117; bHLH 117]

Short Name

[Transcription factor bHLH117 (BHLH117)]

Other Product Names

[basic helix-loop-helix (bHLH) DNA-binding superfamily protein; Transcription factor bHLH117; basic helix-loop-helix (bHLH) DNA-binding superfamily protein; Basic helix-loop-helix protein 117; AtbHLH117; bHLH 117; Transcription factor EN 140; bHLH transcription factor bHLH117]

NCBI GI Number

15233267

NCBI Accession Number

NP_188848.1

NCBI GB Accession Number

NM_113106.2

Uniprot Accession Number

Q9LRJ4

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACCase (Phosphorylated Acetyl-CoA Carboxylase) Rat ELISA Kit
F6555 96 Tests

PACCase (Phosphorylated Acetyl-CoA Carboxylase) Rat ELISA Kit

Sign In for Pricing
View Details
PRKAR1A Rabbit mAb
RDSA67827 100 µL

PRKAR1A Rabbit mAb

Sign In for Pricing
View Details
PPARA (Peroxisome Proliferator Activated Receptor alpha, PPAR, NR1C1, hPPAR, PPARalpha) (Biotin)
MBS6448606-01 0.1 mL

PPARA (Peroxisome Proliferator Activated Receptor alpha, PPAR, NR1C1, hPPAR, PPARalpha) (Biotin)

Sign In for Pricing
View Details
PPARA (Peroxisome Proliferator Activated Receptor alpha, PPAR, NR1C1, hPPAR, PPARalpha) (Biotin)
MBS6448606-02 5x 0.1 mL

PPARA (Peroxisome Proliferator Activated Receptor alpha, PPAR, NR1C1, hPPAR, PPARalpha) (Biotin)

Sign In for Pricing
View Details
TRNAT12 3'UTR GFP Stable Cell Line
TU077166 1.0 mL

TRNAT12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details