Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ATG18F Polyclonal Antibody
MBS7145994 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ATG18F Polyclonal Antibody

Sign In for Pricing
View Details
EDDM3DP Protein Vector (Human) (pPB-C-His)
PV074725 500 ng

EDDM3DP Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
DAPP1 (NM_014395) Human Over-expression Lysate
LS027071-20ug 20 µg

DAPP1 (NM_014395) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Borrelia Duttonii rpoC Protein (aa 1-1377)
VAng-Lsx2003-inquire Inquire

Recombinant Borrelia Duttonii rpoC Protein (aa 1-1377)

Sign In for Pricing
View Details
ALAS1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0070104 1.0 µg DNA

ALAS1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mrm1 sgRNA CRISPR Lentivector set (Mouse)
K3272301 3x 1.0 µg

Mrm1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details