Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

A2M Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV687853 1.0 µg DNA

A2M Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ERF3B, ID (GSPT2, ERF3B, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition protein 2 homolog)
035201 200 µL

ERF3B, ID (GSPT2, ERF3B, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition protein 2 homolog)

Sign In for Pricing
View Details
SB 431542 10mM * 1mL in DMSO
A10826-10mM-D 10 mM x 1mL in DMSO

SB 431542 10mM * 1mL in DMSO

Sign In for Pricing
View Details
ASK1 Rabbit Monoclonal Antibody
AMRe85314-01 1 Each

ASK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ASK1 Rabbit Monoclonal Antibody
AMRe85314-02 50 µL

ASK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ASK1 Rabbit Monoclonal Antibody
AMRe85314-03 100 µL

ASK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details