Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Maspardin (SPG21) ELISA Kit
AE17438MO-01 48 Tests

Mouse Maspardin (SPG21) ELISA Kit

Sign In for Pricing
View Details
Mouse Maspardin (SPG21) ELISA Kit
AE17438MO-02 96 Tests

Mouse Maspardin (SPG21) ELISA Kit

Sign In for Pricing
View Details
C6orf218 Recombinant Protein (Human)
RP005029 100 µg

C6orf218 Recombinant Protein (Human)

Sign In for Pricing
View Details
OLIG2 Western Blot Kit
GWB-6EC267 1 Kit

OLIG2 Western Blot Kit

Sign In for Pricing
View Details
MFAP4 (NM_002404) Human Over-expression Lysate
LH06171V 100 µg

MFAP4 (NM_002404) Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine Type II Collagen-Solution
1220-02S 0.5 mg

Bovine Type II Collagen-Solution

Sign In for Pricing
View Details