Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MAPRE1 Antibody
NBP1-98366 100 µL

Rabbit Polyclonal MAPRE1 Antibody

Sign In for Pricing
View Details
ARMCX2 Rabbit Polyclonal Antibody
E53P08804 100 µL

ARMCX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mid1ip1 (NM_001166635) Mouse Tagged ORF Clone Lentiviral Particle
MR224540L4V 200 µL

Mid1ip1 (NM_001166635) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Atrip (NM_172774) Mouse Tagged ORF Clone Lentiviral Particle
MR218096L3V 200 µL

Atrip (NM_172774) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GENLISA™ Mouse Solute Carrier Family 30 Member 7 (SLC30A7) ELISA
KLM6325 1x 96 Well

GENLISA™ Mouse Solute Carrier Family 30 Member 7 (SLC30A7) ELISA

Sign In for Pricing
View Details
Utomilumab Biosimilar, Research Grade
ABS-306-1mg 1 mg

Utomilumab Biosimilar, Research Grade

Sign In for Pricing
View Details