Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABplex Human 43-Plex Custom Panel
RK04371-01 96 Tests

ABplex Human 43-Plex Custom Panel

Sign In for Pricing
View Details
ABplex Human 43-Plex Custom Panel
RK04371-02 48 Tests

ABplex Human 43-Plex Custom Panel

Sign In for Pricing
View Details
FBXW8 Recombinant Protein (Mouse)
RP134168 100 µg

FBXW8 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
LOC367195 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6453604 1.0 µg DNA

LOC367195 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CCDC151 Protein Vector (Mouse) (pPB-C-His)
PV162218 500 ng

CCDC151 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ECE1 Protein (N-His, Human)
P520960 100 µg

ECE1 Protein (N-His, Human)

Sign In for Pricing
View Details