Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL12P36 siRNA Oligos set (Human)
40789171 3x 5 nmol

RPL12P36 siRNA Oligos set (Human)

Sign In for Pricing
View Details
EPHA10, NT (Ephrin Type-A Receptor 10) (PE) discontinued
E3363-13A-PE 200 µL

EPHA10, NT (Ephrin Type-A Receptor 10) (PE) discontinued

Sign In for Pricing
View Details
SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI) (MaxLight 750)
MBS6240714-01 0.1 mL

SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI) (MaxLight 750)

Sign In for Pricing
View Details
SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI) (MaxLight 750)
MBS6240714-02 5x 0.1 mL

SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody [Alexa Fluor 700]
NB100-530AF700 0.1 mL

Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Goat Interleukin 1 Receptor Associated Kinase (IRAK) ELISA Kit
MBS260857-01 48 Well

Goat Interleukin 1 Receptor Associated Kinase (IRAK) ELISA Kit

Sign In for Pricing
View Details