Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FE65 Rabbit pAb
E47R0110 100 µL

FE65 Rabbit pAb

Sign In for Pricing
View Details
MDC1 Rabbit Polyclonal Antibody
E53P08707 100 µL

MDC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ISG20, ID (ISG20, HEM45, Interferon-stimulated gene 20kD protein, Estrogen-regulated transcript 45 protein, Promyelocytic leukemia nuclear body-associated protein ISG20) (Azide free) (HRP) discontinued
037119-HRP 200 µL

ISG20, ID (ISG20, HEM45, Interferon-stimulated gene 20kD protein, Estrogen-regulated transcript 45 protein, Promyelocytic leukemia nuclear body-associated protein ISG20) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Phospho-Ras-GRF1 (Ser916) Blocking Peptide
MBS9616297-01 1 mg

Phospho-Ras-GRF1 (Ser916) Blocking Peptide

Sign In for Pricing
View Details
Phospho-Ras-GRF1 (Ser916) Blocking Peptide
MBS9616297-02 5x 1 mg

Phospho-Ras-GRF1 (Ser916) Blocking Peptide

Sign In for Pricing
View Details
Pira3 shRNA Plasmid (m)
sc-152274-SH 20 µg

Pira3 shRNA Plasmid (m)

Sign In for Pricing
View Details