Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGRMC2 (Progesterone Receptor Membrane Component 2, DG6, PMBP) (MaxLight 490)
MBS6207884-01 0.1 mL

PGRMC2 (Progesterone Receptor Membrane Component 2, DG6, PMBP) (MaxLight 490)

Sign In for Pricing
View Details
PGRMC2 (Progesterone Receptor Membrane Component 2, DG6, PMBP) (MaxLight 490)
MBS6207884-02 5x 0.1 mL

PGRMC2 (Progesterone Receptor Membrane Component 2, DG6, PMBP) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral mouse Snta1 shRNA (UAS) - Lentiviral mouse Snta1 shRNA (UAS, GFP) plasmid
GTR15255514 1 Vial

Lentiviral mouse Snta1 shRNA (UAS) - Lentiviral mouse Snta1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RGD1562963 Protein Vector (Rat) (pPM-C-HA)
39307026 500 ng

RGD1562963 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
hsa-miR-7848-3p miRNA Antagomir
MBS8318459-01 10 nmol

hsa-miR-7848-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-7848-3p miRNA Antagomir
MBS8318459-02 20 nmol

hsa-miR-7848-3p miRNA Antagomir

Sign In for Pricing
View Details