Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plcl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6153406 1.0 µg DNA

Plcl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Delta Sleep Inducing Peptide a (delta-SIP-a) Human ELISA Kit
C8549 96 Tests

Delta Sleep Inducing Peptide a (delta-SIP-a) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACX1.2 Polyclonal Antibody
MBS9015848 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ACX1.2 Polyclonal Antibody

Sign In for Pricing
View Details
Olr1206 (NM_001000816) Rat Tagged ORF Clone Lentiviral Particle
RR204483L3V 200 µL

Olr1206 (NM_001000816) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
4-Chloromethylbenzophenone
C5024-10 500 mg

4-Chloromethylbenzophenone

Sign In for Pricing
View Details
Arterolane-d6 Tosylate Salt
TRC-A614162-50MG 50 mg

Arterolane-d6 Tosylate Salt

Sign In for Pricing
View Details