Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Eosinophil Peroxidase (EPX) ELISA
KLR3792 1x 96 Well

GENLISA™ Eosinophil Peroxidase (EPX) ELISA

Sign In for Pricing
View Details
CAP2 ORF Vector (Human) (pORF)
ORF001852 1.0 µg DNA

CAP2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RPL7AP17 sgRNA CRISPR Lentivector set (Human)
K1883001 3x 1.0 µg

RPL7AP17 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Anti-ARHGAP17 Rabbit pAb
GB112159-100 100 μL

Anti-ARHGAP17 Rabbit pAb

Sign In for Pricing
View Details
ST3 (Stromelysin-3) Guinea Pig ELISA Kit
H3049 96 Tests

ST3 (Stromelysin-3) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
Dengue Antibody (Types 1, 2, 3, 4)
GWB-7F4A00 1 mg

Dengue Antibody (Types 1, 2, 3, 4)

Sign In for Pricing
View Details