Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTGF (Connective Tissue Growth Factor, Hypertrophic Chondrocyte-specific Protein 24, Insulin-like Growth Factor-binding Protein 8, IGF-binding Protein 8, IGFBP-8, IBP-8, CCN Family Member 2, CCN2, HCS24, IGFBP8) discontinued
029757 100 µg

CTGF (Connective Tissue Growth Factor, Hypertrophic Chondrocyte-specific Protein 24, Insulin-like Growth Factor-binding Protein 8, IGF-binding Protein 8, IGFBP-8, IBP-8, CCN Family Member 2, CCN2, HCS24, IGFBP8) discontinued

Sign In for Pricing
View Details
OR6J1 Antibody
MBS9606658-01 0.1 mL

OR6J1 Antibody

Sign In for Pricing
View Details
OR6J1 Antibody
MBS9606658-02 0.2 mL

OR6J1 Antibody

Sign In for Pricing
View Details
OR6J1 Antibody
MBS9606658-03 5x 0.2 mL

OR6J1 Antibody

Sign In for Pricing
View Details
TAF6 Antibody
MBS7044973-01 0.05 mg

TAF6 Antibody

Sign In for Pricing
View Details
TAF6 Antibody
MBS7044973-02 0.1 mg

TAF6 Antibody

Sign In for Pricing
View Details