Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TATA Element ModULatory Factor 1 (TMF1) Human Gene Knockout Kit (CRISPR)
KN420590 1 Kit

TATA Element ModULatory Factor 1 (TMF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Olr1654 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV625461 1.0 µg DNA

Olr1654 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Goat Uncharacterized Protein C17orf67 (C17ORF67) ELISA Kit
MBS9367703 Inquire

Goat Uncharacterized Protein C17orf67 (C17ORF67) ELISA Kit

Sign In for Pricing
View Details
3-Fluoro-5- (hydrazinecarbonyl) phenylboronic acid
425698-01 100 mg

3-Fluoro-5- (hydrazinecarbonyl) phenylboronic acid

Sign In for Pricing
View Details
3-Fluoro-5- (hydrazinecarbonyl) phenylboronic acid
425698-02 250 mg

3-Fluoro-5- (hydrazinecarbonyl) phenylboronic acid

Sign In for Pricing
View Details
ABCD1P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0020708 1.0 µg DNA

ABCD1P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details