Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF295 (ZBTB21) (NM_001098403) Human Untagged Clone
SC316273 10 µg

ZNF295 (ZBTB21) (NM_001098403) Human Untagged Clone

Sign In for Pricing
View Details
ARFGAP1/3 CRISPR Activation Plasmid (h2)
sc-406509-ACT-2 20 µg

ARFGAP1/3 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
LGALS12 Antibody, Biotin conjugated
A64299-50UG 50 µg

LGALS12 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Cnot7 3'UTR Luciferase Stable Cell Line
TU104116 1.0 mL

Cnot7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZNF562 Blocking Peptide
33R-4602 100 ug

ZNF562 Blocking Peptide

Sign In for Pricing
View Details
Cdk10 (NM_001109937) Rat Tagged ORF Clone
RR200073 10 µg

Cdk10 (NM_001109937) Rat Tagged ORF Clone

Sign In for Pricing
View Details