Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEM1 sgRNA CRISPR Lentivector set (Human)
K0582901 3x 1.0 µg

DEM1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human Secreted Phospholipase A2-X
MBS142470-01 0.002 mg

Recombinant Human Secreted Phospholipase A2-X

Sign In for Pricing
View Details
Recombinant Human Secreted Phospholipase A2-X
MBS142470-02 0.01 mg

Recombinant Human Secreted Phospholipase A2-X

Sign In for Pricing
View Details
Recombinant Human Secreted Phospholipase A2-X
MBS142470-03 1 mg

Recombinant Human Secreted Phospholipase A2-X

Sign In for Pricing
View Details
Recombinant Human Secreted Phospholipase A2-X
MBS142470-04 5x 1 mg

Recombinant Human Secreted Phospholipase A2-X

Sign In for Pricing
View Details
Anti-CD47 Reference Antibody (ligufalimab)
MBS9247538-01 0.1 mg

Anti-CD47 Reference Antibody (ligufalimab)

Sign In for Pricing
View Details