Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-4-fluoroacetophenone
TRC-B684375-5G 5 g

2-Bromo-4-fluoroacetophenone

Sign In for Pricing
View Details
Cerexin D4
HY-N15394 1 Each

Cerexin D4

Sign In for Pricing
View Details
CRMP1 (DPYSL1, ULIP3) discontinued
508363 100 µg

CRMP1 (DPYSL1, ULIP3) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal SURF5 Antibody (PCRP-MED22-2A7) [Alexa Fluor 750]
NBP3-14191AF750 0.1 mL

Mouse Monoclonal SURF5 Antibody (PCRP-MED22-2A7) [Alexa Fluor 750]

Sign In for Pricing
View Details
Rat Ampd3 Pre-designed siRNA Set A
SI200578A 1 Each

Rat Ampd3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal ATG9A Antibody [CoraFluor 1]
NBP3-26074CL1 0.1 mL

Rabbit Polyclonal ATG9A Antibody [CoraFluor 1]

Sign In for Pricing
View Details