Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf141 (NM_080739) Human Over-expression Lysate
LS128653-100ug 100 µg

C20orf141 (NM_080739) Human Over-expression Lysate

Sign In for Pricing
View Details
CITED2 (NM_001168388) Human Tagged ORF Clone Lentiviral Particle
RC229801L4V 200 µL

CITED2 (NM_001168388) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NGLY1 Rabbit pAb
E45R22449N-100 100 µL

NGLY1 Rabbit pAb

Sign In for Pricing
View Details
RCL1, NT (RNA 3'-terminal Phosphate Cyclase-like Protein, RNAC, RPC2, RTC2, HSPC338) (Biotin) discontinued
R1269-80-Biotin 200 µL

RCL1, NT (RNA 3'-terminal Phosphate Cyclase-like Protein, RNAC, RPC2, RTC2, HSPC338) (Biotin) discontinued

Sign In for Pricing
View Details
BAFF/BLyS Protein, Canine, Recombinant (hFc Tag)
PO55009M3 50 µg

BAFF/BLyS Protein, Canine, Recombinant (hFc Tag)

Sign In for Pricing
View Details
RBM46 Rabbit Polyclonal Antibody
E28PN8459 100 µL

RBM46 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details