Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI6 (NM_002038) Human Tagged ORF Clone
RC204958 10 µg

IFI6 (NM_002038) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human CETN1 sgRNA gene knockout kit - Lentiviral human CETN1 sgRNA gene knockout kit (25)
GTR15399345 1 Vial

Lentiviral human CETN1 sgRNA gene knockout kit - Lentiviral human CETN1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Monoclonal SAMD12 Antibody (OTI2G1) [Alexa Fluor 488]
NBP2-73974AF488 0.1 mL

Mouse Monoclonal SAMD12 Antibody (OTI2G1) [Alexa Fluor 488]

Sign In for Pricing
View Details
RYR2 antibody
70R-20056 50 ul

RYR2 antibody

Sign In for Pricing
View Details
MSRA sgRNA CRISPR Lentivector (Human) (Target 1)
K1350502 1.0 µg DNA

MSRA sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Difloxacin Hydrochloride Salt
TRC-D445600-100MG 100 mg

Difloxacin Hydrochloride Salt

Sign In for Pricing
View Details