Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Galnt6 Pre-designed siRNA Set B
SI105254B 1 Each

Mouse Galnt6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
FITC*Polyclonal  Goat  Anti-Human IgG(γ chain)
CE30634-01 1 mL

FITC*Polyclonal Goat Anti-Human IgG(γ chain)

Sign In for Pricing
View Details
FITC*Polyclonal  Goat  Anti-Human IgG(γ chain)
CE30634-02 10 mL

FITC*Polyclonal Goat Anti-Human IgG(γ chain)

Sign In for Pricing
View Details
MSH6 Recombinant Antibody, HRP Conjugated
bsm-60220R-HRP 100 µL

MSH6 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Rat TFF2 Protein, His (Fc)-Avi-tagged
TFF2-5688R 50 µg

Recombinant Rat TFF2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CD300LB Human shRNA Plasmid Kit (Locus ID 124599)
TL305514 1 Kit

CD300LB Human shRNA Plasmid Kit (Locus ID 124599)

Sign In for Pricing
View Details