CD99, Mouse (HEK293, Fc)
CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html
Purity
98.00
Smiles
DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG
Molecular Formula
673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)
Molecular Weight
Approximately 47-55 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
RPS6KB1 (Ser424) (Ribosomal Protein S6 Kinase beta-1, S6K-beta-1, S6K1, 70kD Ribosomal Protein S6 Kinase 1, P70S6K1, p70-S6K 1, p70 Ribosomal S6 Kinase alpha, p70 S6 Kinase alpha, p70 S6K-alpha, p70 S6KA, p70-S6K, Ribosomal Protein S6 Kinase I, Serine/threonine-protein Kinase 14A, STK14A) (Azide free) (HRP) discontinued
SPNS2, NT (SPNS2, Protein spinster homolog 2) (Azide free) (HRP)
SPNS2, NT (SPNS2, Protein spinster homolog 2) (Azide free) (HRP)
Prss8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)