Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PD-1 Antibody (913429) [DyLight 650]
FAB10861W 0.1 mL

Mouse Monoclonal PD-1 Antibody (913429) [DyLight 650]

Sign In for Pricing
View Details
YBX1P8 Protein Vector (Human) (pPM-C-HA)
50599021 500 ng

YBX1P8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Hoxa3, CT (Hoxa3, Hox-1.5, Hoxa-3, Homeobox protein Hox-A3, Homeobox protein Hox-1.5, Homeobox protein MO-10) (MaxLight 550)
MBS6307711-01 0.1 mL

Hoxa3, CT (Hoxa3, Hox-1.5, Hoxa-3, Homeobox protein Hox-A3, Homeobox protein Hox-1.5, Homeobox protein MO-10) (MaxLight 550)

Sign In for Pricing
View Details
Hoxa3, CT (Hoxa3, Hox-1.5, Hoxa-3, Homeobox protein Hox-A3, Homeobox protein Hox-1.5, Homeobox protein MO-10) (MaxLight 550)
MBS6307711-02 5x 0.1 mL

Hoxa3, CT (Hoxa3, Hox-1.5, Hoxa-3, Homeobox protein Hox-A3, Homeobox protein Hox-1.5, Homeobox protein MO-10) (MaxLight 550)

Sign In for Pricing
View Details
Prostaglandin Impurity 30
RM-P151490-01 10 mg

Prostaglandin Impurity 30

Sign In for Pricing
View Details
Prostaglandin Impurity 30
RM-P151490-02 25 mg

Prostaglandin Impurity 30

Sign In for Pricing
View Details