Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G3 Recombinant Protein (Mouse)
RP162527 100 µg

PLA2G3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
EXTL2P-set siRNA/shRNA/RNAi Lentivector (Human)
57229091 4x 500 ng

EXTL2P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Mouse BLMH siRNA
abx909134-01 15 nmol

Mouse BLMH siRNA

Sign In for Pricing
View Details
Mouse BLMH siRNA
abx909134-02 30 nmol

Mouse BLMH siRNA

Sign In for Pricing
View Details
Recombinant Human KXD1 Protein, His, E.coli-100ug
QP12520-100ug 100ug

Recombinant Human KXD1 Protein, His, E.coli-100ug

Sign In for Pricing
View Details
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (Biotin) discontinued
C2399-18A-Biotin 100 µL

CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (Biotin) discontinued

Sign In for Pricing
View Details