Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DOLPP1 Antibody
NBP1-81286-25ul 25 µL

Rabbit Polyclonal DOLPP1 Antibody

Sign In for Pricing
View Details
RPS15AP40 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV783466 1.0 µg DNA

RPS15AP40 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PRAMEF1, CT (PRAMEF1, PRAME family member 1) (MaxLight 490) discontinued
040381-ML490 100 µL

PRAMEF1, CT (PRAMEF1, PRAME family member 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal KIAA1958 Antibody
NBP3-06273-50ul 50 µL

Rabbit Polyclonal KIAA1958 Antibody

Sign In for Pricing
View Details
4,4'-Bis(isocyanatophenyl)oxide
TRC-B448770-250MG 250 mg

4,4'-Bis(isocyanatophenyl)oxide

Sign In for Pricing
View Details
Recombinant Mycobacterium Marinum trpD Protein (aa 1-367)
VAng-Yyj4599-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Marinum trpD Protein (aa 1-367)

Sign In for Pricing
View Details