Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1158505 3x 1.0 µg

KLHL28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Maf Antibody (N-term) Blocking Peptide
MBS9224229-01 0.5 mg

Mouse Maf Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Mouse Maf Antibody (N-term) Blocking Peptide
MBS9224229-02 5x 0.5 mg

Mouse Maf Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
PPP2CBP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1707305 3x 1.0 µg

PPP2CBP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MES Buffer 0.5M, pH 7.0
41320080-1 100 mL

MES Buffer 0.5M, pH 7.0

Sign In for Pricing
View Details
Rat IMPG1 (Interphotoreceptor matrix proteoglycan 1) ELISA Kit
ELI-08231r 96 Tests

Rat IMPG1 (Interphotoreceptor matrix proteoglycan 1) ELISA Kit

Sign In for Pricing
View Details