Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100360929 3'UTR Luciferase Stable Cell Line
TU207768 1.0 mL

LOC100360929 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Pigeon Importin 5 (IPO5) ELISA Kit
MBS9368995 Inquire

Pigeon Importin 5 (IPO5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PAX1 Antibody
NBP3-10116-100ul 100 µL

Rabbit Polyclonal PAX1 Antibody

Sign In for Pricing
View Details
MOX-1 Lentiviral Activation Particles (m)
sc-421627-LAC 200 µL

MOX-1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
OR1L6 (NM_001004453) Human Over-expression Lysate
LC423758 20 µg

OR1L6 (NM_001004453) Human Over-expression Lysate

Sign In for Pricing
View Details
Knudson C Orchid Medium (Morel Modification) w/ Sucrose; w/o Vitamins & Agar
PT066-25L 25 L

Knudson C Orchid Medium (Morel Modification) w/ Sucrose; w/o Vitamins & Agar

Sign In for Pricing
View Details