Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smoc1 (NM_022316) Mouse Tagged Lenti ORF Clone
MR207219L3 10 µg

Smoc1 (NM_022316) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SIGLEC7 Antibody
F40103-0.4ML 0.4 mL

SIGLEC7 Antibody

Sign In for Pricing
View Details
Human CELF6 Pre-designed siRNA Set A
SI002787A 1 Each

Human CELF6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Na-Fmoc- Nd-trityl-L-glutamine 4-alkoxybenzyl alcohol resin
240488-01 1 g

Na-Fmoc- Nd-trityl-L-glutamine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Na-Fmoc- Nd-trityl-L-glutamine 4-alkoxybenzyl alcohol resin
240488-02 5 g

Na-Fmoc- Nd-trityl-L-glutamine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Mouse Anti-Mouse H-2Kk-PE
31-2261-0.1 0.1 mg

Mouse Anti-Mouse H-2Kk-PE

Sign In for Pricing
View Details