Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 Protein Vector (Mouse) (pPB-C-His)
PV163410 500 ng

CD34 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Ifi27l2b sgRNA CRISPR Lentivector set (Mouse)
K4384901 3x 1.0 µg

Ifi27l2b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
MUC1 Antibody
A45558-50UL 50 μL

MUC1 Antibody

Sign In for Pricing
View Details
HDJ2 (DNAJA1) (NM_001539) Human Mass Spec Standard
PH301628 10 µg

HDJ2 (DNAJA1) (NM_001539) Human Mass Spec Standard

Sign In for Pricing
View Details
3- (4-Azidophenyl) propionic acid
259887-01 50 mg

3- (4-Azidophenyl) propionic acid

Sign In for Pricing
View Details
3- (4-Azidophenyl) propionic acid
259887-02 100 mg

3- (4-Azidophenyl) propionic acid

Sign In for Pricing
View Details