Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD99 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd99-protein-mouse-hek293-fc.html

Purity

98.00

Smiles

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Formula

673094 (Gene_ID) Q8VCN6 (D29-G138) (Accession)

Molecular Weight

Approximately 47-55 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTFR Antibody
A17732-50UG 50 µg

CNTFR Antibody

Sign In for Pricing
View Details
PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate
LH04603V 100 µg

PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate

Sign In for Pricing
View Details
Human S4 (PSMC1) (NM_002802) AAV Particle
RC201810A1V 250 µL

Human S4 (PSMC1) (NM_002802) AAV Particle

Sign In for Pricing
View Details
SLC41A2 (Solute Carrier Family 41 Member 2, DKFZp434K0427, DKFZP434K0427, MGC125330, MGC125331, SLC41A1-L1) (APC)
138377-APC 100 µL

SLC41A2 (Solute Carrier Family 41 Member 2, DKFZp434K0427, DKFZP434K0427, MGC125330, MGC125331, SLC41A1-L1) (APC)

Sign In for Pricing
View Details
ELP4 Mouse Monoclonal Antibody [Clone ID: OTI4B2]
CF809145 100 µg

ELP4 Mouse Monoclonal Antibody [Clone ID: OTI4B2]

Sign In for Pricing
View Details
Ataxin 10 Antibody
MBS5315532-01 0.1 mL

Ataxin 10 Antibody

Sign In for Pricing
View Details