Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Major urinary 6, Mouse (His-SUMO)

Major Urinary Protein 6 (MUP6) is crucial in chemical communication, binding to pheromones in male urine. This interaction significantly influences female sexual behavior, regulating mating behaviors and contributing to chemical signaling in reproductive and social contexts. MUP6's specific binding to male-derived pheromones underscores its essential role in mediating these communication processes in the animal kingdom. Major urinary protein 6 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Major urinary protein 6 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Major urinary protein 6 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/major-urinary-protein-6-protein-mouse-his-sumo.html

Smiles

MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Molecular Formula

100038948 (Gene_ID) P02762 (M1-E180) (Accession)

Molecular Weight

Approximately 36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-FOXM1 antibody
PAab03200 100 µg

Anti-FOXM1 antibody

Ask
View Details
MAGIX (NM_001099681) Human Tagged Lenti ORF Clone
RC215753L3 10 µg

MAGIX (NM_001099681) Human Tagged Lenti ORF Clone

Ask
View Details
ELMOD3 Rabbit pAb (APR27477N)
APR27477N-01 50 µL

ELMOD3 Rabbit pAb (APR27477N)

Ask
View Details
ELMOD3 Rabbit pAb (APR27477N)
APR27477N-02 100 µL

ELMOD3 Rabbit pAb (APR27477N)

Ask
View Details
ELMOD3 Rabbit pAb (APR27477N)
APR27477N-03 200 µL

ELMOD3 Rabbit pAb (APR27477N)

Ask
View Details
Cytokeratin 19 (RCK108) HRP
sc-53003 HRP 200 µg/mL

Cytokeratin 19 (RCK108) HRP

Ask
View Details