Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Major urinary 6, Mouse (His-SUMO)

Major Urinary Protein 6 (MUP6) is crucial in chemical communication, binding to pheromones in male urine. This interaction significantly influences female sexual behavior, regulating mating behaviors and contributing to chemical signaling in reproductive and social contexts. MUP6's specific binding to male-derived pheromones underscores its essential role in mediating these communication processes in the animal kingdom. Major urinary protein 6 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Major urinary protein 6 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Major urinary protein 6 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/major-urinary-protein-6-protein-mouse-his-sumo.html

Smiles

MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Molecular Formula

100038948 (Gene_ID) P02762 (M1-E180) (Accession)

Molecular Weight

Approximately 36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human TRPV4 full length protein-synthetic nanodisc
E33F100777 10 µg

Human TRPV4 full length protein-synthetic nanodisc

Ask
View Details
Akirin1 (NM_001030054) Rat Tagged Lenti ORF Clone
RR215493L3 10 µg

Akirin1 (NM_001030054) Rat Tagged Lenti ORF Clone

Ask
View Details
Nori® Hamster IL-18 ELISA Kit
GR172043 96 Well

Nori® Hamster IL-18 ELISA Kit

Ask
View Details
C1QTNF1 Antibody
DF14508-01 100 µL

C1QTNF1 Antibody

Ask
View Details
C1QTNF1 Antibody
DF14508-02 200 µL

C1QTNF1 Antibody

Ask
View Details
Lentiviral mouse Sf3b3 shRNA (UAS) - Lentiviral mouse Sf3b3 shRNA (UAS, iRFP) (25)
GTR15240134 1 Vial

Lentiviral mouse Sf3b3 shRNA (UAS) - Lentiviral mouse Sf3b3 shRNA (UAS, iRFP) (25)

Ask
View Details