Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Major urinary 6, Mouse (His-SUMO)

Major Urinary Protein 6 (MUP6) is crucial in chemical communication, binding to pheromones in male urine. This interaction significantly influences female sexual behavior, regulating mating behaviors and contributing to chemical signaling in reproductive and social contexts. MUP6's specific binding to male-derived pheromones underscores its essential role in mediating these communication processes in the animal kingdom. Major urinary protein 6 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Major urinary protein 6 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Major urinary protein 6 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/major-urinary-protein-6-protein-mouse-his-sumo.html

Smiles

MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Molecular Formula

100038948 (Gene_ID) P02762 (M1-E180) (Accession)

Molecular Weight

Approximately 36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DFFB Knockout HEK293T Polyclonal Cells
ARG3650 1 Million

DFFB Knockout HEK293T Polyclonal Cells

Ask
View Details
NAP1L1 (NM_139207) Human Tagged ORF Clone Lentiviral Particle
RC201851L3V 200 µL

NAP1L1 (NM_139207) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Transmembrane gamma-carboxyglutamic Acid protein 2 (PRRG2) Human ELISA Kit
H8061 96 Tests

Transmembrane gamma-carboxyglutamic Acid protein 2 (PRRG2) Human ELISA Kit

Ask
View Details
Olfr1223 Mouse shRNA Plasmid (Locus ID 258894)
TR507940 1 Kit

Olfr1223 Mouse shRNA Plasmid (Locus ID 258894)

Ask
View Details
Mmu-miR-12194-3p mimic
HY-R02615-01 5 nmol

Mmu-miR-12194-3p mimic

Ask
View Details
Mmu-miR-12194-3p mimic
HY-R02615-02 20 nmol

Mmu-miR-12194-3p mimic

Ask
View Details