Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL4, Mouse

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.CCL4 Protein, Mouse is the recombinant mouse-derived CCL4 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

CCL4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl4-protein-mouse.html

Purity

95.00

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-rno-miR-29c-5p Vector
mr40716 500 ng

LentimiRa-rno-miR-29c-5p Vector

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)
MBS2097143-01 0.1 mL

Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)
MBS2097143-02 0.2 mL

Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)
MBS2097143-03 0.5 mL

Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)
MBS2097143-04 1 mL

Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)
MBS2097143-05 5 mL

Biotin-Linked Polyclonal Antibody to ADP Ribosylation Factor Like Protein 15 (ARL15)

Sign In for Pricing
View Details