Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL4, Mouse

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.CCL4 Protein, Mouse is the recombinant mouse-derived CCL4 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

CCL4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl4-protein-mouse.html

Purity

95.00

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Ubiquitin Protein Ligase E3 Component N-Recognin 4 ELISA Kit
OM623134 96 Strip Well

Bovine Ubiquitin Protein Ligase E3 Component N-Recognin 4 ELISA Kit

Sign In for Pricing
View Details
4-Aminoantipyrine N-carbamic acid methyl ester
259420-01 100 mg

4-Aminoantipyrine N-carbamic acid methyl ester

Sign In for Pricing
View Details
4-Aminoantipyrine N-carbamic acid methyl ester
259420-02 250 mg

4-Aminoantipyrine N-carbamic acid methyl ester

Sign In for Pricing
View Details
4-Aminoantipyrine N-carbamic acid methyl ester
259420-03 500 mg

4-Aminoantipyrine N-carbamic acid methyl ester

Sign In for Pricing
View Details
4-Aminoantipyrine N-carbamic acid methyl ester
259420-04 1 g

4-Aminoantipyrine N-carbamic acid methyl ester

Sign In for Pricing
View Details
4-Aminoantipyrine N-carbamic acid methyl ester
259420-05 2 g

4-Aminoantipyrine N-carbamic acid methyl ester

Sign In for Pricing
View Details