Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A7, Human

The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a7-protein-human.html

Purity

98.0

Smiles

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Molecular Formula

6278 (Gene_ID) P31151 (M1-Q101) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP (Alpha Fetoprotein) (C3), CF640R conjugate, 0.1mg/mL
BNC400354-500 1x 500 µL

AFP (Alpha Fetoprotein) (C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 (Mouse/Rat) Recombinant Monoclonal Hamster Antibody (24MS04.81), CF®488A Conjugate - Biotium Choice
P017-488A-125 1x 125 µL

CD81 (Mouse/Rat) Recombinant Monoclonal Hamster Antibody (24MS04.81), CF®488A Conjugate - Biotium Choice

Sign In for Pricing
View Details
20-Dihydroprogesterone Acetate
TRC-D449690-10MG 10 mg

20-Dihydroprogesterone Acetate

Sign In for Pricing
View Details
Geranylgeranyl Phenyl Sulfide
TRC-G367570-10MG 10 mg

Geranylgeranyl Phenyl Sulfide

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1472), CF594 conjugate, 0.1mg/mL
BNC941472-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/1472), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD4 Antibody[RM4-4]
AN00417J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD4 Antibody[RM4-4]

Sign In for Pricing
View Details