Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A7, Human

The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a7-protein-human.html

Purity

98.0

Smiles

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Molecular Formula

6278 (Gene_ID) P31151 (M1-Q101) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Osteopontin Recombinant Rabbit monoclonal Antibody
HA723925 100 µL

Mouse Osteopontin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ANKRD26P1 (NM_001004299) Human Over-expression Lysate
LY424077 100 µg

ANKRD26P1 (NM_001004299) Human Over-expression Lysate

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF405M conjugate, 0.1mg/mL
BNC050485-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF594 conjugate, 0.1mg/mL
BNC942886-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hieff NGS™ Ultima Endprep Mix
12605ES96 96 Tests

Hieff NGS™ Ultima Endprep Mix

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF594 conjugate, 0.1mg/mL
BNC942302-500 1x 500 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details