Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A7, Human

The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a7-protein-human.html

Purity

98.0

Smiles

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Molecular Formula

6278 (Gene_ID) P31151 (M1-Q101) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (FAS) Rabbit Polyclonal Antibody
TA384208 100 µL

CD95 (FAS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGP1 (MFAP2) Rabbit Polyclonal Antibody
TA366395 100 µL

MAGP1 (MFAP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCB (PC) Rabbit Monoclonal Antibody
TA423951 100 µL

PCB (PC) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
4,4,5,5,6,6,7,7,7-Nonafluoroheptanoic Acid
TRC-A579515-25MG 25 mg

4,4,5,5,6,6,7,7,7-Nonafluoroheptanoic Acid

Sign In for Pricing
View Details
Human RAX activation kit by CRISPRa
GA109380 1 Kit

Human RAX activation kit by CRISPRa

Sign In for Pricing
View Details
cis-Terbinafine
TRC-T107485-25MG 25 mg

cis-Terbinafine

Sign In for Pricing
View Details