Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-36 beta/IL-1F8, Human (His)

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses.It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP.Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 beta/IL-1F8 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-36 beta/IL-1F8 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-36-beta-il-1f8-protein-human-his.html

Purity

98.0

Smiles

MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Molecular Formula

27177 (Gene_ID) Q9NZH7-2 (R5-E157) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABP1 (AOC1) (NM_001091) Human Recombinant Protein
TP304163 20 µg

ABP1 (AOC1) (NM_001091) Human Recombinant Protein

Sign In for Pricing
View Details
P57 / KIP2 (KP10), CF594 conjugate, 0.1mg/mL
BNC940879-500 1x 500 µL

P57 / KIP2 (KP10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF488A conjugate, 0.1mg/mL
BNC880990-100 1x 100 µL

Mucin 3 (M3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phaseolus vulgaris Gel -PHA-L- Immobilized Lectin
AK-1801-2 2 mL

Phaseolus vulgaris Gel -PHA-L- Immobilized Lectin

Sign In for Pricing
View Details
3-Pentanol
TRC-P227295-500ML 500 mL

3-Pentanol

Sign In for Pricing
View Details
3-Chlorobenzyl Cyanide
TRC-C364455-1G 1 g

3-Chlorobenzyl Cyanide

Sign In for Pricing
View Details