Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2, Mouse (HEK293, His)

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd2-protein-mouse-hek293-his.html

Purity

98.0

Smiles

RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS

Molecular Formula

12481 (Gene_ID) P08920/NP_038514.1 (R23-S203) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptx3 Mouse Gene Knockout Kit (CRISPR)
KN514251 1 Kit

Ptx3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BC085271 Mouse Gene Knockout Kit (CRISPR)
KN502068 1 Kit

BC085271 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP27 (HSPB1) pSer78/82 Rabbit Polyclonal Antibody
AP20950PU-N 100 µg

HSP27 (HSPB1) pSer78/82 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIF1 beta (ARNT) Human Gene Knockout Kit (CRISPR)
KN216724LP 1 Kit

HIF1 beta (ARNT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KIF12 activation kit by CRISPRa
GA114395 1 Kit

Human KIF12 activation kit by CRISPRa

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details