Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2, Mouse (HEK293, His)

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd2-protein-mouse-hek293-his.html

Purity

98.0

Smiles

RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS

Molecular Formula

12481 (Gene_ID) P08920/NP_038514.1 (R23-S203) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTSF1 (HRP)
564482-01 50 µg

GTSF1 (HRP)

Sign In for Pricing
View Details
GTSF1 (HRP)
564482-02 100 µg

GTSF1 (HRP)

Sign In for Pricing
View Details
Pnlip (NM_026925) Mouse Recombinant Protein
TP507436 20 µg

Pnlip (NM_026925) Mouse Recombinant Protein

Sign In for Pricing
View Details
N-Cadherin / Cadherin-2 / CD325 (NCAD) (13A9), 0.2mg/mL
BNUB1425-100 1x 100 µL

N-Cadherin / Cadherin-2 / CD325 (NCAD) (13A9), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Anti-Human CD33 mAb (FITC)
E2790275 100 µL

Mouse Anti-Human CD33 mAb (FITC)

Sign In for Pricing
View Details
MYH6 (Myosin-6, Myosin Heavy Chain 6, Myosin Heavy Chain, Cardiac Muscle alpha isoform, MyHC-alpha, MYH6, MYHCA) (MaxLight 490)
MBS6457466-01 0.1 mL

MYH6 (Myosin-6, Myosin Heavy Chain 6, Myosin Heavy Chain, Cardiac Muscle alpha isoform, MyHC-alpha, MYH6, MYHCA) (MaxLight 490)

Sign In for Pricing
View Details