Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOX-1/OLR1, Cynomolgus (HEK293, His)

OLR1 is a type II membrane glycoprotein belonging to C-type lectin family with a short N-terminal cytoplasmic tail and a long C-terminal extracellular domain. OLR1 binds ox-LDL, delipidated, and solubilized ox-LDL. LOX-1/OLR1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

LOX-1/OLR1 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lox-1-olr1-protein-cynomolgus-hek293-his.html

Purity

95.30

Smiles

SQVSNLLKQQQTNLTHQKNKLEGQISARQQAEEASQESQNELKEMIETLAWKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHEENCYLFSTGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRIRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Molecular Formula

/ (Gene_ID) G7PJT2 (S61-Q273) (Accession)

Molecular Weight

Approximately 33 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL
BNC401133-500 1x 500 µL

CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF488A conjugate, 0.1mg/mL
BNC880735-100 1x 100 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details