Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich repeat LGI family member 4 (LGI4)

Product Specifications

Product Name Alternative

(LGI1-like protein 3) (Leucine-rich glioma-inactivated protein 4)

Abbreviation

Recombinant Human LGI4 protein

Gene Name

LGI4

UniProt

Q8N135

Expression Region

20-537aa

Organism

Homo sapiens (Human)

Target Sequence

WRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSPTLLSLSLVRTGVTQLKAGSFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNALRGLRSLTHLSLANNHLETLPRFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSVEPFSYQGEPHIVLAQPFAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSLFVLAARLWGGSQLWARPSPGLRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHAWHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGDVFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLRLEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Component of Schwann cell signaling pathway (s) that controls axon segregation and myelin formation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

61.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NEUROD4 shRNA Plasmid
abx969262-01 150 µg

Mouse NEUROD4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse NEUROD4 shRNA Plasmid
abx969262-02 300 µg

Mouse NEUROD4 shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral human ZBTB14 sgRNA gene knockout kit - Lentiviral human ZBTB14 sgRNA gene knockout kit (100)
GTR15382915 1 Vial

Lentiviral human ZBTB14 sgRNA gene knockout kit - Lentiviral human ZBTB14 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Complement C1q Subcomponent Subunit A, Recombinant, Human, aa23-245, His-Tag, Myc-Tag
584061-01 20 µg

Complement C1q Subcomponent Subunit A, Recombinant, Human, aa23-245, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Complement C1q Subcomponent Subunit A, Recombinant, Human, aa23-245, His-Tag, Myc-Tag
584061-02 100 µg

Complement C1q Subcomponent Subunit A, Recombinant, Human, aa23-245, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Acad12 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4804804 1.0 µg DNA

Acad12 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details