What is the catalog number for CNTF, Rat (His)?

The catalog number for CNTF, Rat (His) is HY-P7148A.

What sizes are available for CNTF, Rat (His)?

CNTF, Rat (His) is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does CNTF, Rat (His) come in?

CNTF, Rat (His) is available in 4 different pack sizes.

Is CNTF, Rat (His) in stock?

CNTF, Rat (His) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures CNTF, Rat (His)?

CNTF, Rat (His) is manufactured by QuantiMol.

What is the estimated delivery time for CNTF, Rat (His)?

Estimated delivery time for CNTF, Rat (His) is approximately 15 business day(s), depending on your location.

CNTF, Rat (His)

CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Rat (His) is produced by E. coli with N-terminal 6*His-tag.

Product Specifications

Product Name Alternative

CNTF Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cntf-protein-rat-his.html

Purity

95.90

Smiles

AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

Molecular Formula

25707 (Gene_ID) P20294 (A2-M200) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[2]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[3]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[4]Saadat S, et al. Ciliary neurotrophic factor induces cholinergic differentiation of rat sympathetic neurons in culture[J]. The Journal of cell biology, 1989, 108 (5) : 1807-1816.