Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Inhibin alpha chain/INHA, Bovine (His-SUMO)

Inhibin alpha chain/INHA protein plays a vital role in regulating pituitary function and contributes to the dual regulation of follicle-stimulating hormone secretion and activin. Inhibin alpha chain/INHA Protein, Bovine (His-SUMO) is the recombinant bovine-derived Inhibin alpha chain/INHA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Inhibin alpha chain/INHA Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/inhibin-alpha-chain-inha-bovine-his-sumo.html

Purity

90.00

Smiles

STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI

Molecular Formula

281254 (Gene_ID) P07994 (S227-I360) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL
BNC940451-100 1x 100 µL

HER-2 / CD340 (HRB2/451), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2966), CF640R conjugate, 0.1mg/mL
BNC402966-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2966), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF640R conjugate, 0.1mg/mL
BNC400264-500 1x 500 µL

Human Kappa Light Chain (KLC264), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details